PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676735130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family YABBY
Protein Properties Length: 228aa    MW: 25568.2 Da    PI: 7.2896
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676735130genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY269.73.7e-83171892170
      YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaesh..ldeslkee.......lleelkveeenlksnvekeesa 92 
                ++ s s+++CyvqCnfC+tilavsvP+tslfk+vtvrCG+Ct+llsv     + +l+a+++  l+ +l ++       +leel+++ +n+++++++++ +
  676735130  17 EHLSPSDHLCYVQCNFCETILAVSVPYTSLFKTVTVRCGCCTNLLSVR----TAVLPASNQlqLQLQLGPHsyfntqnILEELRDAPSNMNMMMMNQHPN 112
                67899*****************************************54....34445555400445555668888899********************** PP

      YABBY  93 stsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                +++++s+ ++ ++++e+p++ppv+rPPekrqrvPsaynrfikeeiqrika+nPdishreafsaaaknWahfP+ihfgl
  676735130 113 MNDIPSF-MDLHQQHEIPKAPPVNRPPEKRQRVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGL 189
                ******6.5*******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.3E-6821189IPR006780YABBY protein
SuperFamilySSF470957.33E-8135182IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.108.3E-5137183IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009909Biological Processregulation of flower development
GO:0009933Biological Processmeristem structural organization
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010093Biological Processspecification of floral organ identity
GO:0010154Biological Processfruit development
GO:0010158Biological Processabaxial cell fate specification
GO:0010159Biological Processspecification of organ position
GO:0010450Biological Processinflorescence meristem growth
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MSMSSMSSPS SAVFSPEHLS PSDHLCYVQC NFCETILAVS VPYTSLFKTV TVRCGCCTNL  60
LSVRTAVLPA SNQLQLQLQL GPHSYFNTQN ILEELRDAPS NMNMMMMNQH PNMNDIPSFM  120
DLHQQHEIPK APPVNRPPEK RQRVPSAYNR FIKEEIQRIK AGNPDISHRE AFSAAAKNWA  180
HFPHIHFGLV PDNQPVKKTN MPQQEGEDNM GMKEGFYAPA ANVGVAPY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00620PBMTransfer from AT2G45190Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0749480.0AF074948.1 Arabidopsis thaliana FIL mRNA, complete cds.
GenBankAF0870150.0AF087015.1 Arabidopsis thaliana abnormal floral organs protein (AFO) mRNA, complete cds.
GenBankAF1365380.0AF136538.1 Arabidopsis thaliana YABBY1 (YABBY1) mRNA, complete cds.
GenBankBT0264090.0BT026409.1 Arabidopsis thaliana At2g45190 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013728413.11e-146PREDICTED: axial regulator YABBY 1 isoform X1
SwissprotO221521e-142YAB1_ARATH; Axial regulator YABBY 1
TrEMBLA0A0D3CUG31e-146A0A0D3CUG3_BRAOL; Uncharacterized protein
STRINGAT2G45190.11e-139(Arabidopsis thaliana)
STRINGscaffold_403460.11e-139(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM22172877
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.11e-136YABBY family protein